Recombinant Mouse Cerebellin-3 (Cbln3)

Product Description

Recombinant Mouse Cerebellin-3 (Cbln3) is available at Gentaur for Next week Delivery.

Gene Name: Cbln3

Alternative Names :

Expression Region : 25-197aa

AA Sequence : QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in synaptic functions in the CNS.

Function : May be involved in synaptic functions in the CNS.

Involvement in disease :

Subcellular location : Endoplasmic reticulum, Golgi apparatus, cis-Golgi network, Secreted, Cell junction, synapse

Protein Families :

Tissue Specificity : Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level).

Paythway :

Uniprot ID : Q9JHG0