Recombinant Mouse Mitogen-activated protein kinase kinase kinase 1 (MAP3K1), partial

Product Description

Recombinant Mouse Mitogen-activated protein kinase kinase kinase 1 (MAP3K1), partial is available at Gentaur for Next week Delivery.

Gene Name: Map3k1

Alternative Names : MAPK/ERK kinase kinase 1;MEK kinase 1;MEKK 1

Expression Region : 1216-1493aa

AA Sequence : QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 34.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.

Function : Component of a protein kinase signal transduction cascade

Involvement in disease : 46,XY sex reversal 6 (SRXY6)

Subcellular location :

Protein Families : Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : P53349