Product Description
Recombinant Mouse Mitogen-activated protein kinase kinase kinase 1 (MAP3K1), partial is available at Gentaur for Next week Delivery.
Gene Name: Map3k1
Alternative Names : MAPK/ERK kinase kinase 1;MEK kinase 1;MEKK 1
Expression Region : 1216-1493aa
AA Sequence : QPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFRTTW
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 34.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
Function : Component of a protein kinase signal transduction cascade
Involvement in disease : 46,XY sex reversal 6 (SRXY6)
Subcellular location :
Protein Families : Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Tissue Specificity :
Paythway : MAPKsignalingpathway
Uniprot ID : P53349
Euro
British Pound
US Dollar