Product Description
Recombinant Staphylococcus aureus Foldase protein PrsA (prsA) is available at Gentaur for Next week Delivery.
Gene Name: prsA
Alternative Names :
Expression Region : 21-320aa
AA Sequence : CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 49.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins.
Function : Plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins.
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor
Protein Families : PrsA family
Tissue Specificity :
Paythway :
Uniprot ID : Q5HET4
Euro
British Pound
US Dollar