Recombinant Staphylococcus aureus Foldase protein PrsA (prsA)

Product Description

Recombinant Staphylococcus aureus Foldase protein PrsA (prsA) is available at Gentaur for Next week Delivery.

Gene Name: prsA

Alternative Names :

Expression Region : 21-320aa

AA Sequence : CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 49.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins.

Function : Plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor

Protein Families : PrsA family

Tissue Specificity :

Paythway :

Uniprot ID : Q5HET4