Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

Product Description

Recombinant Toxocara canis 26 kDa secreted antigen (TES-26) is available at Gentaur for Next week Delivery.

Gene Name: TES-26

Alternative Names : Toxocara excretory-secretory antigen 26 Short name: TES-26

Expression Region : 22-262aa

AA Sequence : QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 9xHis-tagged

Theoretical MW : 27.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds phosphatidylethanolamine.

Function : Binds phosphatidylethanolamine.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Phosphatidylethanolamine-binding protein family

Tissue Specificity :

Paythway :

Uniprot ID : P54190