Product Description
Recombinant Toxocara canis 26 kDa secreted antigen (TES-26) is available at Gentaur for Next week Delivery.
Gene Name: TES-26
Alternative Names : Toxocara excretory-secretory antigen 26 Short name: TES-26
Expression Region : 22-262aa
AA Sequence : QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Sequence Info : Full Length of Mature Protein
Tag Info : C-terminal 9xHis-tagged
Theoretical MW : 27.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds phosphatidylethanolamine.
Function : Binds phosphatidylethanolamine.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Phosphatidylethanolamine-binding protein family
Tissue Specificity :
Paythway :
Uniprot ID : P54190
Euro
British Pound
US Dollar