Product Description
Recombinant Vaccinia virus Protein L3 (VACWR090) is available at Gentaur for Next week Delivery.
Gene Name: VACWR090
Alternative Names : Protein F4
Expression Region : 1-350aa
AA Sequence : MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 42.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Might be required for transcription of early genes.
Function : Might be required for transcription of early genes.
Involvement in disease :
Subcellular location : Virion, Host cytoplasm
Protein Families : Poxviridae L3 family
Tissue Specificity :
Paythway :
Uniprot ID : P07614
Euro
British Pound
US Dollar