Recombinant Vaccinia virus Protein L3 (VACWR090)

Product Description

Recombinant Vaccinia virus Protein L3 (VACWR090) is available at Gentaur for Next week Delivery.

Gene Name: VACWR090

Alternative Names : Protein F4

Expression Region : 1-350aa

AA Sequence : MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 42.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Might be required for transcription of early genes.

Function : Might be required for transcription of early genes.

Involvement in disease :

Subcellular location : Virion, Host cytoplasm

Protein Families : Poxviridae L3 family

Tissue Specificity :

Paythway :

Uniprot ID : P07614