Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)

Product Description

Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) is available at Gentaur for Next week Delivery.

Gene Name: ctxB

Alternative Names : Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid

Expression Region : 22-124aa

AA Sequence : TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Function : The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Involvement in disease :

Subcellular location : Secreted, Host cell membrane

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P01556