Recombinant Haliotis laevigata Perlwapin

Product Description

Recombinant Haliotis laevigata Perlwapin is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 1-134aa

AA Sequence : YGPNLPGCPPGPYPRICARYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCVIYCVGDFDCPGNEKCCGSCPRRCEKPCFD

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell.

Function : Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Nacreous layer of shell.

Paythway :

Uniprot ID : P84811